PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.162660.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 454aa    MW: 50444.7 Da    PI: 5.9392
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.162660.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.5e-083994322154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cucsa.162660.4 399 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 432
                     469*****************************87 PP

2ELK28.82.8e-10353374122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  Cucsa.162660.4 353 ELKHELKNGYKEKIVDIREEIL 374
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-18186230IPR005540KNOX1
PfamPF037901.3E-16188228IPR005540KNOX1
SMARTSM012566.5E-25241297IPR005541KNOX2
PfamPF037914.4E-18248296IPR005541KNOX2
SMARTSM011887.4E-4353374IPR005539ELK domain
PfamPF037892.4E-6353374IPR005539ELK domain
PROSITE profilePS512139.69353373IPR005539ELK domain
PROSITE profilePS5007111.677373436IPR001356Homeobox domain
SMARTSM003895.9E-11375440IPR001356Homeobox domain
SuperFamilySSF466898.98E-16375439IPR009057Homeodomain-like
CDDcd000863.24E-11376437No hitNo description
Gene3DG3DSA:1.10.10.604.4E-25380437IPR009057Homeodomain-like
PfamPF059201.1E-17393432IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MAFRSHLSRD LPLHYANQSQ QQQSERPLSD NTLRSILSDQ LTDHSTAADG SKSENPLQSA  60
PNWLNTALLR NQTPHSHYSG ETTTTAADNV NTDFLNLHTT APNSSGQWLS RPILHRNQSD  120
VIDDVADAAD AMIGATATLS RESDDLKNNS SGGGGDGVNN SDDVAVESDC NEGARGGEAA  180
MNWQNAQFKA EILAHPLYEQ LLSAHVACLR IATPVDQLPR IDSQLSRSQN VAAKYSSLGN  240
GSQSIVSNGK ELDQFMTHYV FLLCSFKEQL QQHVRVHAME AVYACWEIEQ SLQSLTGVSP  300
GVGTGATMSD DDEDQIDSDA MFDGSLEGHD TMGFGPLIPT ESERSLMERV RHELKHELKN  360
GYKEKIVDIR EEILRKRRAG KLPGDTTSVL KAWWQSHSKW PYPTEEDKAK LVQETGLQLK  420
QINNWFINQR KRNWHTNPST STTLKTKRKR YSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1429449RKRNWHTNPSTSTTLKTKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138713.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotO041360.0KNAP3_MALDO; Homeobox protein knotted-1-like 3
TrEMBLA0A0A0LSL30.0A0A0A0LSL3_CUCSA; Uncharacterized protein
STRINGGLYMA04G06810.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-159KNOTTED1-like homeobox gene 3